PDB entry 1pgz

View 1pgz on RCSB PDB site
Description: Crystal Structure of UP1 Complexed With d(TTAGGGTTAG(6-MI)G); A Human Telomeric Repeat Containing 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine (6-MI)
Class: DNA binding protein/DNA
Keywords: protein-DNA complex; UP1; human telomeric repeat; hTR; TR2-11F; RRM; RNA Recognition Motif; 6-MI; 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine; hnRNP A1, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2003-05-28, released 2003-11-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.235
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1pgza1, d1pgza2
  • Chain 'B':
    Compound: 5'-d(*t*tp*ap*gp*gp*gp*tp*tp*ap*gp*(6mi)p*g)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pgzA (A:)
    sksespkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvt
    yatveevdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhl
    rdyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkal
    skqemasasssqrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgzA (A:)
    kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
    vdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlrdyfeq
    ygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkalskqema
    sas
    

  • Chain 'B':
    No sequence available.