PDB entry 1pgy

View 1pgy on RCSB PDB site
Description: Solution structure of the UBA domain in Saccharomyces cerevisiae protein, Swa2p
Class: protein binding
Keywords: UBA, ubiquitin, Swa2, auxilin, ubiquitin-associated domain, PROTEIN BINDING
Deposited on 2003-05-28, released 2004-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Swa2p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SWA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pgyA (A:)
    alvdevkdmeiarlmslglsieeatefyendvtyeryleilkskqke