PDB entry 1pgx

View 1pgx on RCSB PDB site
Description: the 1.66 angstroms x-ray structure of the b2 immunoglobulin-binding domain of streptococcal protein g and comparison to the nmr structure of the b1 domain
Deposited on 1992-04-03, released 1992-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.66 Å
R-factor: 0.191
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1pgx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pgx_ (-)
    eltpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftv
    temvtevpva