PDB entry 1pgu

View 1pgu on RCSB PDB site
Description: YEAST ACTIN INTERACTING PROTEIN 1 (AIP1), Se-Met PROTEIN, MONOCLINIC CRYSTAL FORM
Class: protein binding
Keywords: WD repeat, seven-bladed beta-propeller, PROTEIN BINDING
Deposited on 2003-05-28, released 2003-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin interacting protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: AIP1 OR YMR092C OR YM9582.17C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46680
      • modified residue (173)
      • modified residue (176)
      • modified residue (359)
      • modified residue (366)
      • modified residue (508)
      • engineered (529)
      • modified residue (573)
    Domains in SCOPe 2.06: d1pgua1, d1pgua2
  • Chain 'B':
    Compound: Actin interacting protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: AIP1 OR YMR092C OR YM9582.17C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46680 (Start-614)
      • modified residue (173)
      • modified residue (176)
      • modified residue (359)
      • modified residue (366)
      • modified residue (508)
      • engineered (529)
      • modified residue (573)
    Domains in SCOPe 2.06: d1pgub1, d1pgub2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pguA (A:)
    mssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgdskvppvvqft
    ghgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkesnsvevnvksefqvlagpis
    diswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsqrinachlkqsrpmrsmtvg
    ddgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgefvitvgsdrkiscfdgksge
    flkyieddqepvqggifalswldsqkfatvgadatirvwdvttskcvqkwtldkqqlgnq
    qvgvvatgngriislsldgtlnfyelghdevlktisghnkgitaltvnplisgsydgrim
    ewssssmhqdhsnlivsldnskaqeyssiswddtlkvngitkhefgsqpkvasanndgft
    avltndddllilqsftgdiiksvrlnspgsavslsqnyvavgleegntiqvfklsdlevs
    fdlktplrakpsyisispsetyiaagdvmgkillydlqsrevktsrwafrtskinaiswk
    paekganeeeieedlvatgsldtnifiysvkrpmkiikalnahkdgvnnllwetpstlvs
    sgadacikrwnvvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pguA (A:)
    ssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgdskvppvvqftg
    hgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkesnsvevnvksefqvlagpisd
    iswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsqrinachlkqsrpmrsmtvgd
    dgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgefvitvgsdrkiscfdgksgef
    lkyieddqepvqggifalswldsqkfatvgadatirvwdvttskcvqkwtldkqqlgnqq
    vgvvatgngriislsldgtlnfyelghdevlktisghnkgitaltvnplisgsydgrime
    wssssmhqdhsnlivsldnskaqeyssiswddtlkvngitkhefgsqpkvasanndgfta
    vltndddllilqsftgdiiksvrlnspgsavslsqnyvavgleegntiqvfklsdlevsf
    dlktplrakpsyisispsetyiaagdvmgkillydlqsrevktsrwafrtskinaiswkp
    aeeieedlvatgsldtnifiysvkrpmkiikalnahkdgvnnllwetpstlvssgadaci
    krwnvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pguB (B:)
    mssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgdskvppvvqft
    ghgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkesnsvevnvksefqvlagpis
    diswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsqrinachlkqsrpmrsmtvg
    ddgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgefvitvgsdrkiscfdgksge
    flkyieddqepvqggifalswldsqkfatvgadatirvwdvttskcvqkwtldkqqlgnq
    qvgvvatgngriislsldgtlnfyelghdevlktisghnkgitaltvnplisgsydgrim
    ewssssmhqdhsnlivsldnskaqeyssiswddtlkvngitkhefgsqpkvasanndgft
    avltndddllilqsftgdiiksvrlnspgsavslsqnyvavgleegntiqvfklsdlevs
    fdlktplrakpsyisispsetyiaagdvmgkillydlqsrevktsrwafrtskinaiswk
    paekganeeeieedlvatgsldtnifiysvkrpmkiikalnahkdgvnnllwetpstlvs
    sgadacikrwnvvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pguB (B:)
    ssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgdskvppvvqftg
    hgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkesnsvevnvksefqvlagpisd
    iswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsqrinachlkqsrpmrsmtvgd
    dgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgefvitvgsdrkiscfdgksgef
    lkyieddqepvqggifalswldsqkfatvgadatirvwdvttskcvqkwtldkqqlgnqq
    vgvvatgngriislsldgtlnfyelghdevlktisghnkgitaltvnplisgsydgrime
    wssssmhqdhsnlivsldnskaqeyssiswddtlkvngitkhefgsqpkvasanndgfta
    vltndddllilqsftgdiiksvrlnspgsavslsqnyvavgleegntiqvfklsdlevsf
    dlktplrakpsyisispsetyiaagdvmgkillydlqsrevktsrwafrtskinaiswkp
    aeeieedlvatgsldtnifiysvkrpmkiikalnahkdgvnnllwetpstlvssgadaci
    krwnvvle