PDB entry 1pgs

View 1pgs on RCSB PDB site
Description: the three-dimensional structure of pngase f, a glycosylasparaginase from flavobacterium meningosepticum
Deposited on 1994-10-06, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pgs_ (-)
    dntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewdrya
    nvyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetwlak
    greysvdfdivygtpdykysavvpviqynkssidgvpygkahtlglkkniqlptntekay
    lrttisgwghakpydagsrgcaewcfrthtiainnantfqhqlgalgcsanpinnqspgn
    wtpdragwcpgmavptridvlnnsltgstfsyeykfqswtnngtngdafyaissfviaks
    ntpisapvvtn