PDB entry 1pgq

View 1pgq on RCSB PDB site
Description: crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for nadp specificity and the enzyme mechanism
Class: oxidoreductase (choh(d)-nadp+(a))
Keywords: oxidoreductase (choh(d)-nadp+(a))
Deposited on 1994-07-18, released 1995-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.17 Å
R-factor: 0.169
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgqa1, d1pgqa2
  • Heterogens: SO4, 2AM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pgqA (A:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem
    vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi
    lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgddgagh
    fvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieitasilk
    fqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialm
    wrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqagipmp
    cfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghggsvssssy
    na
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgqA (A:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem
    vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi
    lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgddgagh
    fvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieitasilk
    fqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialm
    wrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqagipmp
    cfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghgg