PDB entry 1pgj

View 1pgj on RCSB PDB site
Description: x-ray structure of 6-phosphogluconate dehydrogenase from the protozoan parasite t. brucei
Class: oxidoreductase
Keywords: oxidoreductase, choh(d)-nadp+(b)
Deposited on 1998-03-16, released 1998-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: 0.186
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: T. BRUCEI GND
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgja1, d1pgja2
  • Chain 'B':
    Compound: 6-phosphogluconate dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: T. BRUCEI GND
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgjb1, d1pgjb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pgjA (A:)
    smdvgvvglgvmganlalniaekgfkvavfnrtyskseefmkanasapfagnlkafetme
    afaaslkkprkalilvqagaatdstieqlkkvfekgdilvdtgnahfkdqgrraqqleaa
    glrflgmgisggeegarkgpaffpggtlsvweeirpiveaaaakaddgrpcvtmngsgga
    gscvkmyhnsgeyailqiwgevfdilramglnndevaavledwksknflksymldisiaa
    arakdkdgsyltehvmdrigskgtglwsaqealeigvpapslnmavvsrqftmykterqa
    nasnapgitqspgytlknkspsgpeikqlydsvciaiiscyaqmfqclremdkvhnfgln
    lpatiatfragcilqgyllkpmteafeknpnisnlmcafqteiraglqnyrdmvalitsk
    levsipvlsaslnyvtamftptlkygqlvslqrdvfgrhgyervdkdgresfqwpelq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pgjB (B:)
    smdvgvvglgvmganlalniaekgfkvavfnrtyskseefmkanasapfagnlkafetme
    afaaslkkprkalilvqagaatdstieqlkkvfekgdilvdtgnahfkdqgrraqqleaa
    glrflgmgisggeegarkgpaffpggtlsvweeirpiveaaaakaddgrpcvtmngsgga
    gscvkmyhnsgeyailqiwgevfdilramglnndevaavledwksknflksymldisiaa
    arakdkdgsyltehvmdrigskgtglwsaqealeigvpapslnmavvsrqftmykterqa
    nasnapgitqspgytlknkspsgpeikqlydsvciaiiscyaqmfqclremdkvhnfgln
    lpatiatfragcilqgyllkpmteafeknpnisnlmcafqteiraglqnyrdmvalitsk
    levsipvlsaslnyvtamftptlkygqlvslqrdvfgrhgyervdkdgresfqwpelq