PDB entry 1pg7

View 1pg7 on RCSB PDB site
Description:
Deposited on 2003-05-27, released 2003-08-26
The last revision prior to the SCOP 1.69 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1pg7h1, d1pg7h2
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1pg7i1, d1pg7i2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1pg7l1, d1pg7l2
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1pg7m1, d1pg7m2
  • Chain 'W':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1pg7w1, d1pg7w2
  • Chain 'X':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1pg7x1, d1pg7x2
  • Chain 'Y':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1pg7y1, d1pg7y2
  • Chain 'Z':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1pg7z1, d1pg7z2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pg7H (H:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pg7H (H:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1pg7I (I:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pg7I (I:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pg7L (L:)
    diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pg7M (M:)
    diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pg7W (W:)
    qavvtqesaltsspgetvtltcrsstgavttsnyanwvqekpdhlftgviggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvnl
    fppsseelktkkatlvctitefypgavrvdwkadgtpvtqgdettqpskqsnnkymassy
    ltltaeaweshssyschvthegqsveksls
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pg7X (X:)
    evqlqqsgpelvkpgasvkisckasgysftghllnwvkqshgknlewiglvhphngaity
    nqkfkdkatltvdrssttayielvrltsndsavyycaredfryhysmdywgqgtsvtvss
    akttppsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsvtcnvahpasstkvdkkivpk
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pg7Y (Y:)
    qavvtqesaltsspgetvtltcrsstgavttsnyanwvqekpdhlftgviggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvnl
    fppsseelktkkatlvctitefypgavrvdwkadgtpvtqgdettqpskqsnnkymassy
    ltltaeaweshssyschvthegqsveksls
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pg7Z (Z:)
    evqlqqsgpelvkpgasvkisckasgysftghllnwvkqshgknlewiglvhphngaity
    nqkfkdkatltvdrssttayielvrltsndsavyycaredfryhysmdywgqgtsvtvss
    akttppsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsvtcnvahpasstkvdkkivpk