PDB entry 1pg6

View 1pg6 on RCSB PDB site
Description: X-Ray Crystal Structure of Protein SPYM3_0169 from Streptococcus pyogenes. Northeast Structural Genomics Consortium Target DR2.
Deposited on 2003-05-27, released 2003-12-02
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-02, with a file datestamp of 2003-12-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.213
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pg6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pg6A (A:)
    lehhhhhmvdnrmrftidqnmqfplveidlehggsvylqqgsmvyhtenvtlntklngkg
    sglgklvgaigrsmvsgesmfitqamsngdgklalapntpgqivalelgekqyrlndgaf
    laldgsaqykmerqnigkalfggqgglfvmtteglgtllansfgsikkitldggtmtidn
    ahvvawsreldydihlengfmqsigtgegvvntfrghgeiyiqslnleqfagtlkrylpt
    ssn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pg6A (A:)
    rmrftidqnmqfplveidlehggsvylqqgsmvyhtenvtlntklnglgklvgaigrsmv
    sgesmfitqamsngdgklalapntpgqivalelgekqyrlndgaflaldgsaqykmerqn
    iggglfvmtteglgtllansfgsikkitldggtmtidnahvvawsreldydihlengfmq
    sigtgegvvntfrghgeiyiqslnleqfagtlkryl