PDB entry 1pg6

View 1pg6 on RCSB PDB site
Description: X-Ray Crystal Structure of Protein SPYM3_0169 from Streptococcus pyogenes. Northeast Structural Genomics Consortium Target DR2.
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS; Streptococcus pyogenes; SpyM3_0169, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2003-05-27, released 2003-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.213
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein SpyM3_0169
    Species: Streptococcus pyogenes [TaxId:186103]
    Gene: SPS0176
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8P2Q3
      • modified residue (12)
      • modified residue (20)
      • modified residue (42)
      • modified residue (73)
      • modified residue (79)
      • modified residue (85)
      • modified residue (130)
      • modified residue (149)
      • modified residue (175)
      • modified residue (200)
    Domains in SCOPe 2.08: d1pg6a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pg6A (A:)
    lehhhhhmvdnrmrftidqnmqfplveidlehggsvylqqgsmvyhtenvtlntklngkg
    sglgklvgaigrsmvsgesmfitqamsngdgklalapntpgqivalelgekqyrlndgaf
    laldgsaqykmerqnigkalfggqgglfvmtteglgtllansfgsikkitldggtmtidn
    ahvvawsreldydihlengfmqsigtgegvvntfrghgeiyiqslnleqfagtlkrylpt
    ssn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pg6A (A:)
    rmrftidqnmqfplveidlehggsvylqqgsmvyhtenvtlntklnglgklvgaigrsmv
    sgesmfitqamsngdgklalapntpgqivalelgekqyrlndgaflaldgsaqykmerqn
    iggglfvmtteglgtllansfgsikkitldggtmtidnahvvawsreldydihlengfmq
    sigtgegvvntfrghgeiyiqslnleqfagtlkryl