PDB entry 1pg5

View 1pg5 on RCSB PDB site
Description: crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Deposited on 2003-05-27, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pg5A (A:)
    lkhiisaynfsrdeledifaltdkysknlndtrkilsgktisiaffepstrtylsfqkai
    inlggdvigfsgeestsvakgenladtirmlnnysdgivmrhkydgasrfaseisdipvi
    nagdgkhehptqavidiytinkhfntidglvfallgdlkyartvnsllriltrfrpklvy
    lispqllrarkeildelnypvkevenpfevinevdvlyvtriqkerfvdemeyekikgsy
    ivsldlankmkkdsiilhplprvneidrkvdkttkakyfeqasygvpvrmsiltkiyge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pg5A (A:)
    lkhiisaynfsrdeledifaltdkysknlndtrkilsgktisiaffepstrtylsfqkai
    inlggdvigfsgegenladtirmlnnysdgivmrhkydgasrfaseisdipvinagdgkh
    ehptqavidiytinkhfntidglvfallgdlkyartvnsllriltrfrpklvylispqll
    rarkeildelnypvkevenpfevinevdvlyvtriqkerfvdemeyekikgsyivsldla
    nkmkkdsiilhplprvneidrkvdkttkakyfeqasygvpvrmsiltkiyge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pg5B (B:)
    mefmmeiqgnrkelmvskikngtvidhipagrafavlnvlgikghegfrialvinvdskk
    mgkkdivkiedkeisdteanlitliaptatinivreyevvkktklevpkvvkgilkcpnp
    ycitsndveaiptfktltekplkmrceycetiideneimsqilgannk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pg5B (B:)
    mvskikngtvidhipagrafavlnvlgikegfrialvinvdskkmgkkdivkiedkeisd
    teanlitliaptatinivreyevvkktklevpkvvkgilkcpnpycitsndveaiptfkt
    ltekplkmrceycetiideneimsqilg