PDB entry 1pfz

View 1pfz on RCSB PDB site
Description: proplasmepsin ii from plasmodium falciparum
Deposited on 1998-07-07, released 1999-01-13
The last revision prior to the SCOP 1.65 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.214
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1pfza_
  • Chain 'B':
    Domains in SCOP 1.65: d1pfzb_
  • Chain 'C':
    Domains in SCOP 1.65: d1pfzc_
  • Chain 'D':
    Domains in SCOP 1.65: d1pfzd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pfzA (A:)
    grgsehltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielv
    dfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekd
    gtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwk
    dlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnh
    dlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlc
    nnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrky
    ftvfdydnhsvgialakknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pfzA (A:)
    hltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielvdfqni
    mfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkve
    mtvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwkdlsigsvdpi
    vvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnhdlywqitlda
    hvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnsklptfef
    tsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvfdydnhs
    vgialakknl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pfzB (B:)
    grgsehltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielv
    dfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekd
    gtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwk
    dlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnh
    dlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlc
    nnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrky
    ftvfdydnhsvgialakknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pfzB (B:)
    ehltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielvdfqn
    imfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkv
    emvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwkdlsigsvdpi
    vvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnhdlywqitlda
    hvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnsklptfef
    tsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvfdydnhs
    vgialakkn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pfzC (C:)
    grgsehltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielv
    dfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekd
    gtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwk
    dlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnh
    dlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlc
    nnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrky
    ftvfdydnhsvgialakknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pfzC (C:)
    ehltigfkvenahdrilktikthklknyikesvnflnsgltvdfqnimfygdaevgdnqq
    pftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkvemvsgffskdlvtv
    gnlslpykfievidtngfeptytastfdgilglgwkdlsigsvdpivvelknqnkienal
    ftfylpvhdkhtgfltiggieerfyegpltyeklnhdlywqitldahvgnimlekanciv
    dsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnsklptfeftsengkytlepeyy
    lqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pfzD (D:)
    grgsehltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielv
    dfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekd
    gtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwk
    dlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnh
    dlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlc
    nnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrky
    ftvfdydnhsvgialakknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pfzD (D:)
    hltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielvdfqni
    mfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkve
    mvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwkdlsigsvdpiv
    velknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnhdlywqitldah
    vgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnsklptfeft
    sengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvfdydnhsv
    gialakknl