PDB entry 1pfx

View 1pfx on RCSB PDB site
Description: porcine factor ixa
Class: hydrolase/hydrolase inhibitor
Keywords: hemophilia/egf, blood coagulation, plasma, serine protease, calcium-binding, hydrolase, glycoprotein, hydrolase-hydrolase inhibitor complex
Deposited on 1995-07-19, released 1996-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.198
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: factor ixa
    Species: Sus scrofa [TaxId:9823]
    Gene: PETE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16293 (0-226)
      • conflict (161)
      • conflict (181)
    Domains in SCOPe 2.08: d1pfxc_
  • Chain 'L':
    Compound: factor ixa
    Species: Sus scrofa [TaxId:9823]
    Gene: PETE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pfxl1, d1pfxl2, d1pfxl3
  • Heterogens: 0G6

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pfxC (C:)
ivggenakpgqfpwqvllngkidafcggsiinekwvvtaahciepgvkitvvageyntee
tepteqrrnviraiphhsynatvnkyshdialleldepltlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfnrgrsatilqylkvplvdratclrstkftiysnmfcagfheggkds
cqgdsggphvtevegtsfltgiiswgeecavkgkygiytkvsryvnwikektklt

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pfxL (L:)
ynsgkleefvrgnlerecieekcsfeearevfentektnefwkqyvdgdqcepnpclngg
lckddinsyecwcqvgfegknceldatcnikngrckqfcktgadskvlcscttgyrlapd
qksckpavpfpcgrvsvshspttltr