PDB entry 1pfs

View 1pfs on RCSB PDB site
Description: solution nmr structure of the single-stranded DNA binding protein of the filamentous pseudomonas phage pf3, minimized average structure
Class: DNA binding protein
Keywords: DNA-binding protein, viral, bacteriophage pf3, single-stranded DNA, DNA binding protein
Deposited on 1996-08-03, released 1997-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pf3 single-stranded DNA binding protein
  Species: Pseudomonas phage Pf3 [TaxId:10872]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03672 (0-77)
  Domains in SCOPe 2.08: d1pfsa_
• Chain 'B':
  Compound: pf3 single-stranded DNA binding protein
  Species: Pseudomonas phage Pf3 [TaxId:10872]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03672 (0-77)
  Domains in SCOPe 2.08: d1pfsb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pfsA (A:)
  mniqitftdsvrqgtsakgnpytfqegflhledkphplqcqffvesvipagsyqvpyrin
  vnngrpelafdfkamkra
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pfsB (B:)
  mniqitftdsvrqgtsakgnpytfqegflhledkphplqcqffvesvipagsyqvpyrin
  vnngrpelafdfkamkra