PDB entry 1pfm
View 1pfm on RCSB PDB site
Description: pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 1-15 of a 27-model set.
Class: cytokine
Keywords: cytokine
Deposited on
1995-07-18, released
1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -3.99
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: pf4-m2 chimera
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P02776 (5-67)
- engineered (6)
- engineered (8)
Domains in SCOPe 2.08: d1pfma_ - Chain 'B':
Compound: pf4-m2 chimera
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P02776 (5-67)
- engineered (6)
- engineered (8)
Domains in SCOPe 2.08: d1pfmb_ - Chain 'C':
Compound: pf4-m2 chimera
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P02776 (5-67)
- engineered (6)
- engineered (8)
Domains in SCOPe 2.08: d1pfmc_ - Chain 'D':
Compound: pf4-m2 chimera
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P02776 (5-67)
- engineered (6)
- engineered (8)
Domains in SCOPe 2.08: d1pfmd_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1pfmA (A:)
msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
iikklles
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1pfmB (B:)
msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
iikklles
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1pfmC (C:)
msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
iikklles
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1pfmD (D:)
msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
iikklles