PDB entry 1pfm

View 1pfm on RCSB PDB site
Description: pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 1-15 of a 27-model set.
Class: cytokine
Keywords: cytokine
Deposited on 1995-07-18, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -3.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pf4-m2 chimera
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02776 (5-67)
      • engineered (6)
      • engineered (8)
    Domains in SCOPe 2.08: d1pfma_
  • Chain 'B':
    Compound: pf4-m2 chimera
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02776 (5-67)
      • engineered (6)
      • engineered (8)
    Domains in SCOPe 2.08: d1pfmb_
  • Chain 'C':
    Compound: pf4-m2 chimera
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02776 (5-67)
      • engineered (6)
      • engineered (8)
    Domains in SCOPe 2.08: d1pfmc_
  • Chain 'D':
    Compound: pf4-m2 chimera
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02776 (5-67)
      • engineered (6)
      • engineered (8)
    Domains in SCOPe 2.08: d1pfmd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfmA (A:)
    msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
    iikklles
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfmB (B:)
    msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
    iikklles
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfmC (C:)
    msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
    iikklles
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfmD (D:)
    msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
    iikklles