PDB entry 1pfj

View 1pfj on RCSB PDB site
Description: solution structure of the n-terminal ph/ptb domain of the tfiih p62 subunit
Deposited on 2003-05-27, released 2004-06-08
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-06, with a file datestamp of 2004-07-06.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1pfja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfjA (A:)
    matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
    akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan