PDB entry 1pfi

View 1pfi on RCSB PDB site
Description: pf1 virus structure: helical coat protein and DNA with paraxial phosphates
Class: Virus
Keywords: COMPLEX(VIRAL COAT PROTEIN-DNA), Helical virus, Virus
Deposited on 1994-04-06, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: FIBER
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major coat protein of pf1 virus
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pfia_
  • Chain 'B':
    Compound: major coat protein of pf1 virus
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pfib_
  • Chain 'C':
    Compound: 2'-deoxycytidine-5'-monophosphate
    Species: Pseudomonas phage Pf1 [TaxId:10871]
  • Chain 'D':
    Compound: 2'-deoxycytidine-5'-monophosphate
    Species: Pseudomonas phage Pf1 [TaxId:10871]

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfiA (A:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfiB (B:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.