PDB entry 1pfh

View 1pfh on RCSB PDB site
Description: the phosphorylated form of the histidine-containing phosphocarrier protein hpr
Class: transport protein
Keywords: phosphocarrier protein, transport protein
Deposited on 1995-08-18, released 1995-11-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospho-hpr
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA04 (0-84)
  Domains in SCOPe 2.03: d1pfha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pfhA (A:)
  mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
  vtisaegedeqkavehlvklmaele