PDB entry 1pfd

View 1pfd on RCSB PDB site
Description: the solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures
Class: electron transport
Keywords: [2fe-2s] ferredoxin, solution structure, paramagnetism, nuclear relaxation, electron transport
Deposited on 1998-05-05, released 1999-05-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Petroselinum crispum [TaxId:4043]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pfda_
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfdA (A:)
    atynvklitpdgevefkcdddvyvldqaeeegidipyscragscsscagkvvsgsidqsd
    qsflddeqmdagyvltchayptsdvviethkeeeiv