PDB entry 1pfc

View 1pfc on RCSB PDB site
Description: molecular-replacement structure of guinea pig igg1 p*fc(prime) refined at 3.1 angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1981-10-28, released 1982-02-03
The last revision prior to the SCOP 1.75 freeze date was dated 1986-01-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: 0.303
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg1 pfc' fc
    Domains in SCOP 1.75: d1pfca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pfcA (A:)
    itrtiskakgppripevyllppprnelskkkvsltcmitgfypadinvewdssepsdykn
    tppvfdtdgsfflysrlkvdtdawnngesftcsvmhealpnhviqksisrspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pfcA (A:)
    rtiskakgppripevyllppprnelskkkvsltcmitgfypadinvewdssepsdykntp
    pvfdtdgsfflysrlkvdtdawnngesftcsvmhealpnhviqksisrspg