PDB entry 1pfc

View 1pfc on RCSB PDB site
Description: molecular-replacement structure of guinea pig igg1 p*fc(prime) refined at 3.1 angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1981-10-28, released 1982-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: 0.303
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg1 pfc' fc
    Species: Cavia porcellus [TaxId:10141]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PFC (Start-112)
    Domains in SCOPe 2.08: d1pfca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1pfcA (A:)
itrtiskakgppripevyllppprnelskkkvsltcmitgfypadinvewdssepsdykn
tppvfdtdgsfflysrlkvdtdawnngesftcsvmhealpnhviqksisrspg

    Sequence, based on observed residues (ATOM records): (download) 
    >1pfcA (A:)
rtiskakgppripevyllppprnelskkkvsltcmitgfypadinvewdssepsdykntp
pvfdtdgsfflysrlkvdtdawnngesftcsvmhealpnhviqksisrspg