PDB entry 1pfb

View 1pfb on RCSB PDB site
Description: Structural Basis for specific binding of polycomb chromodomain to histone H3 methylated at K27
Class: peptide binding protein
Keywords: chromatin, histone methylation, polycomb, chromodomain, PEPTIDE BINDING PROTEIN
Deposited on 2003-05-24, released 2003-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polycomb protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: PC OR CG7618
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pfba_
  • Chain 'B':
    Compound: Histone H3, embryonic
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06352 (0-10)
      • modified residue (7)
  • Heterogens: CL, BME, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfbA (A:)
    dlvyaaekiiqkrvkkgvveyrvkwkgwnqryntwepevnildrrlidiyeqtnk
    

  • Chain 'B':
    No sequence available.