PDB entry 1pf5

View 1pf5 on RCSB PDB site
Description: Structural Genomics, Protein YJGH
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, BETA BARREL, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-05-23, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yjgH
    Species: Escherichia coli [TaxId:562]
    Gene: YJGH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pf5a_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pf5A (A:)
    mvertavfpagrhslyaehrysaairsgdllfvsgqvgsredgtpepdfqqqvrlafdnl
    hatlaaagctfddiidvtsfhtdpenqfedimtvkneifsappypnwtavgvtwlagfdf
    eikviaripeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pf5A (A:)
    vertavfpagrhslyaehrysaairsgdllfvsgqvgsredgtpepdfqqqvrlafdnlh
    atlaaagctfddiidvtsfhtdpenqfedimtvkneifsappypnwtavgvtwlagfdfe
    ikviaripeq