PDB entry 1pf0

View 1pf0 on RCSB PDB site
Description: M. loti Ion Channel Cylic Nucleotide Binding Domain
Class: membrane protein
Keywords: Dimer Helical bundle beta barrel core with cyclic AMP bound
Deposited on 2003-05-23, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-10-26, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cnbd
    Species: Mesorhizobium loti
    Database cross-references and differences (RAF-indexed):
    • GB NP_104392 (0-End)
    Domains in SCOPe 2.07: d1pf0a_
  • Chain 'C':
    Compound: cnbd
    Species: Mesorhizobium loti
    Database cross-references and differences (RAF-indexed):
    • GB NP_104392 (0-End)
  • Heterogens: BR, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pf0A (A:)
    vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
    gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
    aeifrktalerrgaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pf0A (A:)
    vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
    gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
    aeifrktalerrg
    

  • Chain 'C':
    No sequence available.