PDB entry 1pez

View 1pez on RCSB PDB site
Description: Bacillus circulans strain 251 mutant A230V
Class: transferase
Keywords: glycosyltransferase, transferase, cyclodextrin
Deposited on 2003-05-23, released 2003-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.155
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrin glucanotransferase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43379 (0-685)
      • engineered (5)
      • engineered (229)
      • engineered (399)
      • engineered (659)
      • engineered (677)
    Domains in SCOPe 2.07: d1peza1, d1peza2, d1peza3, d1peza4
  • Heterogens: MAL, CA, EPE, MPD, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pezA (A:)
    apdtsssnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
    indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
    liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
    tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdvvkhmpfgwqk
    sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
    yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
    gteqymsggtdpdnraripsfststtayqviqklaplrksnpaiaygstqerwinndvli
    yerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllngntlsvgsggaasnf
    tlaaggtavwqytaatatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgad
    itswedtqikvkipavaggnynikvanaagtasnvydnfevlsgdqvsvrfvvnnattal
    gqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvpagktiefkflkkqgsta
    tweggsnhtftapssgtgtinvnwqp