PDB entry 1pey

View 1pey on RCSB PDB site
Description: Crystal structure of the Response Regulator Spo0F complexed with Mn2+
Class: transferase
Keywords: Cation Binding, (alpha/beta) protein
Deposited on 2003-05-22, released 2004-05-18
The last revision prior to the SCOP 1.75 freeze date was dated 2004-05-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.225
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06628
      • engineered (12)
    Domains in SCOP 1.75: d1peya_
  • Chain 'B':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06628
      • engineered (12)
    Domains in SCOP 1.75: d1peyb_
  • Chain 'C':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06628
      • engineered (12)
    Domains in SCOP 1.75: d1peyc_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1peyA (A:)
    mmnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1peyA (A:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1peyB (B:)
    mmnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1peyB (B:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylplk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1peyC (C:)
    mmnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1peyC (C:)
    mnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmd
    gieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl