PDB entry 1pew

View 1pew on RCSB PDB site
Description: High Resolution Crystal Structure of Jto2, a mutant of the non-amyloidogenic Lamba6 Light Chain, Jto
Class: immune system
Keywords: Beta Sheet, IMMUNE SYSTEM
Deposited on 2003-05-22, released 2004-07-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.253
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jto2, a LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN
    Species: Homo sapiens [TaxId:9606]
    Gene: Jto
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pewa_
  • Chain 'B':
    Compound: Jto2, a LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN
    Species: Homo sapiens [TaxId:9606]
    Gene: Jto
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pewb_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pewA (A:)
    nfmlnqphsvsespgktvtisctrssgniasnyvqwyqqrsapitviyednqrpsgvpdr
    fagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pewA (A:)
    nfmlnqphsvsespgktvtisctrssgniasnyvqwyqqsapitviyednqrpsgvpdrf
    agsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pewB (B:)
    nfmlnqphsvsespgktvtisctrssgniasnyvqwyqqrsapitviyednqrpsgvpdr
    fagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pewB (B:)
    nfmlnqphsvsespgktvtisctrssgniasnyvqwyqqsapitviyednqrpsgvpdrf
    agsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg