PDB entry 1pev

View 1pev on RCSB PDB site
Description: crystal structure of the actin interacting protein from caenorhabditis elegans
Deposited on 2003-05-22, released 2003-07-01
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-01, with a file datestamp of 2003-07-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pevA (A:)
    msefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehsh
    qttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaa
    vgegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppf
    kfkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsg
    svfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsi
    sangfinfvnpelgsidqvryghnkaitalsssadgktlfsadaeghinswdistgisnr
    vfpdvhatmitgikttskgdlftvswddhlkvvpaggsgvdsskavanklssqplglavs
    adgdiavaacykhiaiyshgkltevpisynsscvalsndkqfvavggqdskvhvyklsga
    svsevktivhpaeitsvafsnngaflvatdqsrkvipysvannfelahtnswtfhtakva
    cvswspdnvrlatgsldnsvivwnmnkpsdhpiiikgahamssvnsviwlnettivsagq
    dsnikfwnvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pevA (A:)
    sefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehshq
    ttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaav
    gegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppfk
    fkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsgs
    vfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsis
    angfinfvnpelgsidqvryghnkaitalsssadgktlfsadaeghinswdistgisnrv
    fpdvhatmitgikttskgdlftvswddhlkvvpaggsgvdsskavanklssqplglavsa
    dgdiavaacykhiaiyshgkltevpisynsscvalsndkqfvavggqdskvhvyklsgas
    vsevktivhpaeitsvafsnngaflvatdqsrkvipysvannfelahtnswtfhtakvac
    vswspdnvrlatgsldnsvivwnmnkpsdhpiiikgahamssvnsviwlnettivsagqd
    snikfwnvpf