PDB entry 1peu

View 1peu on RCSB PDB site
Description: Ribonucleotide Reductase Protein R1E from Salmonella typhimurium
Class: oxidoreductase
Keywords: 10 stranded alpha/beta barrel, protein-specificity-effector complex, dATP, OXIDOREDUCTASE
Deposited on 2003-05-22, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.206
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase 2 alpha chain
    Species: Salmonella typhimurium [TaxId:602]
    Gene: NRDE OR STM2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1peua1, d1peua2
  • Heterogens: MG, DTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1peuA (A:)
    matttpervmqetmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqh
    erlgtlvregyyddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgk
    rylehfedrvtmvaltlaqgdetlatqltdemlsgrfqpatptflncgkqqrgelvscfl
    lriednmesigravnsalqlskrgggvafllsnlreagapikrienqssgvipvmkmled
    afsyanqlgarqgagavylhahhpdilrfldtkrenadekiriktlslgvvipditfrla
    kenaqmalfspydiqrrygkpfgdiaiserydeliadphvrktyinardffqtlaeiqfe
    sgypyimfedtvnranpiagrinmsnlcseilqvnsasryddnldythighdiscnlgsl
    niahvmdspdigrtvetairgltavsdmshirsvpsiaagnaashaiglgqmnlhgylar
    egiaygspealdftnlyfytitwhavhtsmrlarergktfagfaqsryasgdyftqylqd
    dwqpktakvralfarsgitlptremwlklrddvmrygiynqnlqavpptgsisyinhats
    sihpivakieirkegktgrvyypapfmtnenldmyqdaydigpekiidtyaeatrhvdqg
    lsltlffpdtattrdinkaqiyawrkgikslyyirlrqlalegteiegcvscal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1peuA (A:)
    rvmqetmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlv
    regyyddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfe
    drvtmvaltlaqgdetlatqltdemlsgrfqpatptflncgkqqrgelvscfllriednm
    esigravnsalqlskrgggvafllsnlreagapikrienqssgvipvmkmledafsyanq
    lgarqgagavylhahhpdilrfldtkrenadekiriktlslgvvipditfrlakenaqma
    lfspydiqrrygkpfgdiaiserydeliadphvrktyinardffqtlaeiqfesgypyim
    fedtvnranpiagrinmsnlcseilqvnsasryddnldythighdiscnlgslniahvmd
    spdigrtvetairgltavsdmshirsvpsiaagnaashaiglgqmnlhgylaregiaygs
    pealdftnlyfytitwhavhtsmrlarergktfagfaqsryasgdyftqylqddwqpkta
    kvralfarsgitlptremwlklrddvmrygiynqnlqavpptgsisyinhatssihpiva
    kieirkegktgrvyypapfmtnenldmyqdaydigpekiidtyaeatrhvdqglsltlff
    pdtattrdinkaqiyawrkgikslyyirlrql