PDB entry 1per

View 1per on RCSB PDB site
Description: the complex between phage 434 repression DNA-binding domain and operator site or3: structural differences between consensus and non-consensus half-sites
Class: transcription/DNA
Keywords: protein-DNA complex, transcription/DNA complex
Deposited on 1993-11-09, released 1994-01-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*ap*gp*tp*ap*cp*ap*gp*tp*tp*tp*tp*tp*cp*tp*tp*g p*tp*ap*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*tp*ap*cp*ap*ap*gp*ap*ap*ap*ap*ap*cp*tp*gp*t p*ap*cp*t)-3')
  • Chain 'L':
    Compound: protein (434 repressor)
    Species: Phage 434 [TaxId:10712]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1perl_
  • Chain 'R':
    Compound: protein (434 repressor)
    Species: Phage 434 [TaxId:10712]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1perr_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1perL (L:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngtsdsnvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1perL (L:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngt
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1perR (R:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngtsdsnvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1perR (R:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngt