PDB entry 1peg

View 1peg on RCSB PDB site
Description: Structural basis for the product specificity of histone lysine methyltransferases
Deposited on 2003-05-21, released 2003-08-05
The last revision prior to the SCOP 1.71 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.22
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1pega_
  • Chain 'B':
    Domains in SCOP 1.71: d1pegb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pegA (A:)
    irsfathaqlpisivnreddaflnpnfrfidhsiigknvpvadqsfrvgcscasdeecmy
    stcqcldemapdsdeeadpytrkkrfayysqgakkgllrdrvlqsqepiyechqgcacsk
    dcpnrvvergrtvplqifrtkdrgwgvkcpvnikrgqfvdrylgeiitseeadrrraest
    iarrkdvylfaldkfsdpdsldpllagqplevdgeymsgptrfinhscdpnmaifarvgd
    hadkhihdlalfaikdipkgteltfdyvngltglesdahdpskisemtkclcgtakcrgy
    lw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pegA (A:)
    lpisivnreddaflnpnfrfidhsiigknvpvadqsfrvgcscasdeecmystcqcldem
    apdpytrkkrfayysqgakkgllrdrvlqsqepiyechqgcacskdcpnrvvergrtvpl
    qifrtkdrgwgvkcpvnikrgqfvdrylgeiitseeadrrraestiarrkdvylfaldkf
    sdpdsldpllagplevdgeymsgptrfinhscdpnmaifarvgdhadkhihdlalfaikd
    ipkgteltfdyvnclcgtakcrgylw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pegB (B:)
    irsfathaqlpisivnreddaflnpnfrfidhsiigknvpvadqsfrvgcscasdeecmy
    stcqcldemapdsdeeadpytrkkrfayysqgakkgllrdrvlqsqepiyechqgcacsk
    dcpnrvvergrtvplqifrtkdrgwgvkcpvnikrgqfvdrylgeiitseeadrrraest
    iarrkdvylfaldkfsdpdsldpllagqplevdgeymsgptrfinhscdpnmaifarvgd
    hadkhihdlalfaikdipkgteltfdyvngltglesdahdpskisemtkclcgtakcrgy
    lw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pegB (B:)
    lpisivnreddaflnpnfrfidhsiigknvpvadqsfrvgcscasdeecmystcqcldem
    apkrfayysqgakkgllrdrvlqsqepiyechqgcacskdcpnrvvergrtvplqifrtk
    drgwgvkcpvnikrgqfvdrylgeiitseeadrrraestiarrkdvylfaldkfsdpdsl
    levdgeymsgptrfinhscdpnmaifarvgdhadkhihdlalfaikdipkgteltfdyvn
    gtkclcgtakcrgylw