PDB entry 1pee

View 1pee on RCSB PDB site
Description: Crystal Structure of Nitrophorin 2 complex with imidazole
Class: signaling protein
Keywords: beta barrel, lipocalin, imidazole, ferric heme, dimer, SIGNALING PROTEIN
Deposited on 2003-05-21, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.188
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin 2
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26241 (0-179)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1peea1, d1peea2
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1peeA (A:)
    mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
    ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
    iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl