PDB entry 1ped

View 1ped on RCSB PDB site
Description: bacterial secondary alcohol dehydrogenase (apo-form)
Deposited on 1995-12-28, released 1997-07-07
The last revision prior to the SCOP 1.71 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.215
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pedA (A:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pedB (B:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pedC (C:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pedD (D:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil