PDB entry 1pe9

View 1pe9 on RCSB PDB site
Description: mutations in the t1.5 loop of pectate lyase a
Class: lyase
Keywords: parallel beta helix
Deposited on 2003-05-21, released 2004-03-16
The last revision prior to the SCOP 1.75 freeze date was dated 2004-03-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.198
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase A
    Species: Erwinia chrysanthemi
    Gene: PELA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29155 (0-360)
      • engineered (214)
      • engineered (216)
      • engineered (218-219)
    Domains in SCOP 1.75: d1pe9a_
  • Chain 'B':
    Compound: pectate lyase A
    Species: Erwinia chrysanthemi
    Gene: PELA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29155 (0-360)
      • engineered (214)
      • engineered (216)
      • engineered (218-219)
    Domains in SCOP 1.75: d1pe9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pe9A (A:)
    aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
    gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
    vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
    vqhdgaldikrgsdyvtisnslidqhdktmlighsdsngsqdkgklhvtlfnnvfnrvte
    raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
    vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
    l
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pe9B (B:)
    aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
    gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
    vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
    vqhdgaldikrgsdyvtisnslidqhdktmlighsdsngsqdkgklhvtlfnnvfnrvte
    raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
    vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
    l