PDB entry 1pe6

View 1pe6 on RCSB PDB site
Description: refined x-ray structure of papain(dot)e-64-c complex at 2.1-angstroms resolution
Class: hydrolase (sulfhydryl proteinase)
Keywords: hydrolase (sulfhydryl proteinase)
Deposited on 1991-05-14, released 1993-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.159
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00784 (0-211)
      • conflict (46)
      • conflict (117)
      • conflict (134)
    Domains in SCOPe 2.08: d1pe6a_
  • Heterogens: E6C, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pe6A (A:)
    ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
    ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
    llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
    wgengyirikrgtgnsygvcglytssfypvkn