PDB entry 1pe4

View 1pe4 on RCSB PDB site
Description: solution structure of toxin cn12 from centruroides noxius alfa scorpion toxin acting on sodium channels. nmr structure
Class: toxin
Keywords: toxin, scorpion toxin, centruroides noxius, sodium channels alpha toxin
Deposited on 2003-05-21, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Neurotoxin Cn11
  Species: Centruroides noxius [TaxId:6878]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63019 (0-66)
  Domains in SCOPe 2.08: d1pe4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pe4A (A:)
  rdgyplasngckfgcsglgennptcnhvcekkagsdygycyawtcycehvaegtvlwgds
  gtgpcrs