PDB entry 1pe3

View 1pe3 on RCSB PDB site
Description: Solution structure of the disulphide-linked dimer of human intestinal trefoil factor (TFF3)
Class: cell cycle
Keywords: intestinal trefoil factor, ITF, trefoil factor family, TFF3, TFF3 dimer, trefoil motif, solution structure, NMR spectroscopy, CELL CYCLE
Deposited on 2003-05-21, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Trefoil factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TFF3 OR ITF OR TFI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pe31_
  • Chain '2':
    Compound: Trefoil factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TFF3 OR ITF OR TFI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pe32_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pe31 (1:)
    eeyvglsanqcavpakdrvdcgyphvtpkecnnrgccfdsripgvpwcfkplqeaectf
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pe32 (2:)
    eeyvglsanqcavpakdrvdcgyphvtpkecnnrgccfdsripgvpwcfkplqeaectf