PDB entry 1pe1

View 1pe1 on RCSB PDB site
Description: Aquifex aeolicus KDO8PS in complex with cadmium and 2-PGA
Class: lyase
Keywords: beta(8)/alpha(8) barrel
Deposited on 2003-05-20, released 2004-02-03
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Aquifex aeolicus
    Gene: kdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pe1a_
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Aquifex aeolicus
    Gene: kdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pe1b_
  • Heterogens: PO4, CD, 2PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pe1A (A:)
    mekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgl
    eygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgra
    vnvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakvi
    ydathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpl
    sqlegiieaileirevaskyyetipvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pe1A (A:)
    mekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgl
    eygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgra
    vnvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakvi
    ydathsvqlpgggmrefifpliraavavgcdgvfmethpepekalsdastqlplsqlegi
    ieaileirevaskyyeti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pe1B (B:)
    mekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgl
    eygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgra
    vnvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakvi
    ydathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpl
    sqlegiieaileirevaskyyetipvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pe1B (B:)
    ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
    ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
    nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
    dathsvqlpggmrefifpliraavavgcdgvfmethpepekalsdastqlplsqlegiie
    aileirevaskyyeti