PDB entry 1pdx

View 1pdx on RCSB PDB site
Description: putidaredoxin
Class: electron transfer
Keywords: electron transfer, cytochrome p450cam, ferredoxin, iron-sulfur cluster
Deposited on 1999-02-15, released 1999-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (putidaredoxin)
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pdxa_
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pdxA (A:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw