PDB entry 1pdr

View 1pdr on RCSB PDB site
Description: crystal structure of the third pdz domain from the human homolog of discs large protein
Class: signal transduction
Keywords: signal transduction, sh3 domain
Deposited on 1996-07-26, released 1997-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human discs large protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12959 (Start-98)
      • conflict (96-97)
    Domains in SCOPe 2.07: d1pdra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pdrA (A:)
    ddeitreprkvvlhrgstglgfnivggedgegifisfilaggpadlsgelrkgdriisvn
    svdlraasheqaaaalknagqavtivaqyrpeeysrqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pdrA (A:)
    itreprkvvlhrgstglgfnivggedgegifisfilaggpadlsgelrkgdriisvnsvd
    lraasheqaaaalknagqavtivaqyrpeeysrqha