PDB entry 1pdq

View 1pdq on RCSB PDB site
Description: polycomb chromodomain complexed with the histone h3 tail containing trimethyllysine 27.
Deposited on 2003-05-20, released 2003-08-26
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.223
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pdqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1pdqA (A:)
mkkhhhhhhdnatddpvdlvyaaekiiqkrvkkgvveyrvkwkgwnqryntwepevnild
rrlidiyeqtnk

    Sequence, based on observed residues (ATOM records): (download) 
    >1pdqA (A:)
dlvyaaekiiqkrvkkgvveyrvkwkgwnqryntwepevnildrrlidiye