PDB entry 1pdq

View 1pdq on RCSB PDB site
Description: Polycomb chromodomain complexed with the histone H3 tail containing trimethyllysine 27.
Class: structural protein
Keywords: methyllysine, chromodomain, histone H3, polycomb, lysine methylation, trimethyllysine, cation-pi, chromo, STRUCTURAL PROTEIN
Deposited on 2003-05-20, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.223
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polycomb protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: PC OR CG7618
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pdqa_
  • Chain 'B':
    Compound: Histone H3.3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06351
      • engineered (12)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pdqA (A:)
    mkkhhhhhhdnatddpvdlvyaaekiiqkrvkkgvveyrvkwkgwnqryntwepevnild
    rrlidiyeqtnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pdqA (A:)
    dlvyaaekiiqkrvkkgvveyrvkwkgwnqryntwepevnildrrlidiye
    

  • Chain 'B':
    No sequence available.