PDB entry 1pdk

View 1pdk on RCSB PDB site
Description: papd-papk chaperone-pilus subunit complex from e.coli p pilus
Class: chaperone
Keywords: chaperone, pilus, bacterial adhesion
Deposited on 1999-03-29, released 1999-08-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.235
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (chaperone protein papd)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pdka1, d1pdka2
  • Chain 'B':
    Compound: protein (protein papk)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pdkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pdkA (A:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvkkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pdkA (A:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pdkB (B:)
    sdvafrgnlldrpchvsgdslnkhvvfktrasrdfwyppgrsptesfvirlenchatavg
    kivtltfkgteeaalpghlkvtgvnagrlgialldtdgssllkpgtshnkgqgekvtgns
    lelpfgayvvatpealrtksvvpgdyeatatfeltyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pdkB (B:)
    lldrpchvsgdslnkhvvfktrasrdfwyppgrsptesfvirlenchatavgkivtltfk
    gteeaalpghlkvtgvnagrlgialldtdgssllkpgtshnkgqgekvtgnslelpfgay
    vvatpealrtksvvpgdyeatatfeltyr