PDB entry 1pdc

View 1pdc on RCSB PDB site
Description: refined solution structure and ligand-binding properties of pdc-109 domain b. a collagen-binding type II domain
Class: collagen-binding type II domain
Keywords: collagen-binding type II domain
Deposited on 1991-10-10, released 1994-01-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: seminal fluid protein pdc-109
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02784 (0-44)
  Domains in SCOPe 2.01: d1pdca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pdcA (A:)
  dyakcvfpfiyggkkyetctkigsmwmswcslspnydkdrawkyc