PDB entry 1pd7

View 1pd7 on RCSB PDB site
Description: Extended SID of Mad1 bound to the PAH2 domain of mSin3B
Class: transcription
Keywords: pah2, sin3, mad1, eukaryotic transcriptional regulation, protein-protein interactions
Deposited on 2003-05-19, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sin3b protein
    Species: Mus musculus [TaxId:10090]
    Gene: SIN3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd7a_
  • Chain 'B':
    Compound: Mad1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pd7A (A:)
esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
evanlfrgqedllsefgqflpeakr

  • Chain 'B':
    No sequence available.