PDB entry 1pd7

View 1pd7 on RCSB PDB site
Description: extended sid of mad1 bound to the pah2 domain of msin3b
Deposited on 2003-05-19, released 2004-01-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1pd7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pd7A (A:)
  esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
  evanlfrgqedllsefgqflpeakr