PDB entry 1pd6

View 1pd6 on RCSB PDB site
Description: The NMR structure of domain C2 of human cardiac Myosin Binding Protein C
Class: structural protein
Keywords: Ig domain, STRUCTURAL PROTEIN
Deposited on 2003-05-19, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-07-22, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, cardiac-type, Domain C2
    Species: Homo sapiens [TaxId:9606]
    Gene: MYBPC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pd6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pd6A (A:)
    mhhhhhhssmdekkstafqkklepayqvskghkirltveladhdaevkwlkngqeiqmsg
    skyifesigakrtltisqcsladdaayqcvvggekcstelfvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd6A (A:)
    dekkstafqkklepayqvskghkirltveladhdaevkwlkngqeiqmsgskyifesiga
    krtltisqcsladdaayqcvvggekcstelfvke