PDB entry 1pd5

View 1pd5 on RCSB PDB site
Description: Crystal structure of E.coli chloramphenicol acetyltransferase type I at 2.5 Angstrom resolution
Class: transferase
Keywords: trimer, chloramphenicol, acetyltransferase, TRANSFERASE
Deposited on 2003-05-19, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5a_
  • Chain 'B':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5b_
  • Chain 'C':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5c_
  • Chain 'D':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5d_
  • Chain 'E':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5e_
  • Chain 'F':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5f_
  • Chain 'G':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5g_
  • Chain 'H':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5h_
  • Chain 'I':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5i_
  • Chain 'J':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5j_
  • Chain 'K':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5k_
  • Chain 'L':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: CAT OR HCM1.206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pd5l_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pd5A (A:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5A (A:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewqgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pd5B (B:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5B (B:)
    kkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihi
    larlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysq
    dvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdk
    vlmplaiqvhhavcdgfhvgrmlnelqqycdewqgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pd5C (C:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5C (C:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewqgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pd5D (D:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5D (D:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewqgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pd5E (E:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5E (E:)
    kkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihi
    larlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysq
    dvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdk
    vlmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pd5F (F:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5F (F:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1pd5G (G:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5G (G:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewqgg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pd5H (H:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5H (H:)
    kitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihil
    arlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqd
    vacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkv
    lmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1pd5I (I:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5I (I:)
    kitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihil
    arlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqd
    vacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkv
    lmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1pd5J (J:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5J (J:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1pd5K (K:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5K (K:)
    kitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihil
    arlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqd
    vacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkv
    lmplaiqvhhavcdgfhvgrmlnelqqycdew
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1pd5L (L:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pd5L (L:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdew