PDB entry 1pcz

View 1pcz on RCSB PDB site
Description: structure of tata-binding protein
Class: DNA-binding protein
Keywords: transcription regulation, DNA-binding protein, nuclear protein
Deposited on 1996-10-04, released 1997-01-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tata-binding protein
    Species: Pyrococcus woesei [TaxId:2262]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pcza1, d1pcza2
  • Chain 'B':
    Compound: tata-binding protein
    Species: Pyrococcus woesei [TaxId:2262]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pczb1, d1pczb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pczA (A:)
    mvdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallif
    ssgklvvtgaksvqdieravaklaqklksigvkfkrapqidvqnmvfsgdigrefnldvv
    altlpnceyepeqfpgviyrvkepksvillfssgkivcsgakseadaweavrkllreldk
    yglleeeeeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pczA (A:)
    vdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallifs
    sgklvvtgaksvqdieravaklaqklksigvkfkrapqidvqnmvfsgdigrefnldvva
    ltlpnceyepeqfpgviyrvkepksvillfssgkivcsgakseadaweavrkllreldky
    gll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pczB (B:)
    mvdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallif
    ssgklvvtgaksvqdieravaklaqklksigvkfkrapqidvqnmvfsgdigrefnldvv
    altlpnceyepeqfpgviyrvkepksvillfssgkivcsgakseadaweavrkllreldk
    yglleeeeeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pczB (B:)
    vdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallifs
    sgklvvtgaksvqdieravaklaqklksigvkfkrapqidvqnmvfsgdigrefnldvva
    ltlpnceyepeqfpgviyrvkepksvillfssgkivcsgakseadaweavrkllreldky
    gll