PDB entry 1pcx

View 1pcx on RCSB PDB site
Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Bet1
Class: transport protein
Keywords: transport protein
Deposited on 2003-05-18, released 2003-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein transport protein SEC24
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pcxa1, d1pcxa2, d1pcxa3, d1pcxa4, d1pcxa5
  • Chain 'B':
    Compound: COPII-binding peptide of the protein transport protein BET1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pcxA (A:)
    aapaygqpsaamgqnmrpmnqlypidlltelpppitdltlpppplvippermlvpselsn
    aspdyirstlnavpknssllkksklpfglvirpyqhlyddidppplnedglivrcrrcrs
    ymnpfvtfieqgrrwrcnfcrlandvpmqmdqsdpndpksrydrneikcavmeymapkey
    tlrqpppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihy
    fkipldsenneesadqinmmdiadleepflprpnsmvvslkacrqnietlltkipqifqs
    nlitnfalgpalksayhliggvggkiivvsgtlpnlgigklqrrnesgvvntsketaqll
    scqdsfyknftidcskvqitvdlflasedymdvaslsnlsrftagqthfypgfsgknpnd
    ivkfstefakhismdfcmetvmrargstglrmsrfyghffnrssdlcafstmprdqsylf
    evnvdesimadycyvqvavllslnnsqrririitlamptteslaevyasadqlaiasfyn
    skavekalnsslddarvlinksvqdilatykkeivvsntaggaplrlcanlrmfpllmhs
    ltkhmafrsgivpsdhrasalnnleslplkylikniypdvyslhdmadeaglpvqtedge
    atgtivlpqpinatsslferyglylidngnelflwmggdavpalvfdvfgtqdifdipig
    kqeipvvensefnqrvrniinqlrnhddvityqslyivrgaslsepvnhasarevatlrl
    wasstlvedkilnnesyreflqimkarisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pcxA (A:)
    rpmnqlypidlltelpppitdltlpppplvippermlvpselsnaspdyirstlnavpkn
    ssllkksklpfglvirpyqhlyddidppplnedglivrcrrcrsymnpfvtfieqgrrwr
    cnfcrlandvpmqmdqpksrydrneikcavmeymapkeytlrqpppatycflidvsqssi
    ksgllattintllqnldsipnhdertrisilcvdnaihyfkipldseninmmdiadleep
    nsmvvslkacrqnietlltkipqifqsnlitnfalgpalksayhliggvggkiivvsgtl
    pnlgigklqrdsfyknftidcskvqitvdlflasedymdvaslsnlsrftagqthfypgf
    sgknpndivkfstefakhismdfcmetvmrargstglrmsrfyghffnrssdlcafstmp
    rdqsylfevnvdesimadycyvqvavllslnnsqrririitlamptteslaevyasadql
    aiasfynskavekalnsslddarvlinksvqdilatykkeivaggaplrlcanlrmfpll
    mhsltkhmafrsgivpsdhrasalnnleslplkylikniypdvyslhdmadeaglpvgti
    vlpqpinatsslferyglylidngnelflwmggdavpalvfdvfgtqdifdipigkqeip
    vvensefnqrvrniinqlrnhddvityqslyivrgaslsepvnhasarevatlrlwasst
    lvedkilnnesyreflqimkarisk
    

  • Chain 'B':
    No sequence available.